Recombinant Human ALKBH5
|
Cat.No.:REH- Q6P6C2 |
|||||
|
Product Background |
|||||
|
Recombinant Human Probable alpha-ketoglutarate-dependent dioxygenase ABH5(ALKBH5) |
|||||
|
Enables mRNA N6-methyladenosine dioxygenase activity and molecular condensate scaffold activity. Involved in membraneless organelle assembly; post-transcriptional regulation of gene expression; and response to hypoxia. Acts upstream of or within regulation of mRNA export from nucleus and regulation of mRNA processing. Located in Golgi apparatus; cytosol; and nuclear speck. Is active in paraspeckles.Dioxygenase that demethylates RNA by oxidative demethylation: specifically demethylates N(6)-methyladenosine (m6A) RNA, the most prevalent internal modification of messenger RNA (mRNA) in higher eukaryotes. Can also demethylate N(6)-methyladenosine in single-stranded DNA (in vitro). |
|||||
|
Product Information |
|||||
|
Source |
E.coli |
||||
|
Molecular Weight |
48.2 kDa(2-394AA) |
||||
|
AA Sequence |
AAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEPYPVSGAKRKYQ EDSDPERSDYEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTV DRAPLRNKYFFGEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFV NSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSV TVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRLETKSLSSSVLPPSYASDRLSGNNRDP ALKPKRSHRKADPDAAHRPRILEMDKEENRRSVLLPTHRRRGSFSSENYWRKSYESSEDCSEA AGSPARKVKMRRH |
||||
|
Tag Information |
N-terminal 6xHis-tagged |
||||
|
Physical Appearance |
Liquid or Lyophilized powder |
||||
|
Formulation |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
||||
|
Endotoxin |
Less than 1 EU/mg of Recombinant Protein as determined by LAL method. |
||||
|
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20¡æ/-80¡æ. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
||||
|
Purity |
>90 % by SDS-PAGE. |
||||
|
Stability & Storage |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
||||
|
12 months from date of receipt, -20 to -80 ¡ãC as supplied. |
|||||
|
1 month, 2 to 8 ¡ãC under sterile conditions after reconstitution. |
|||||
|
3 months, -20 to -70 ¡ãC under sterile conditions after reconstitution. |
|||||
|
Usage Information |
|||||
|
This product is offered by InCellGen only for Scientific Research & Laboratory USE. NOT FOR OTHER USE. |
|||||
|
Order Information |
|
||||
|
Quantity |
Price($£© |
Price(€) |
Price(£¤/CNY£© |
Price(£¤/JYP£© |
|
|
20ug |
$260.00 |
€ 312.00 |
£¤2,600.00 |
£¤51,740.00 |
|
|
100ug |
$505.00 |
€ 606.00 |
£¤5,050.00 |
£¤100,495.00 |
|
|
1mg |
$2,150.00 |
€ 2,580.00 |
£¤21,500.00 |
£¤427,850.00 |
|
|
Free Delivery on orders over $200.00. |
|||||
|
We Devoted Ourselves To The Development Of Biomedical Research Reagent. |
|||||


