|
Recombinant Mouse THBS1 |
|||||
|
Cat.No.:CYT-Q80YQ1 |
|||||
|
Product Background |
|||||
|
Recombinant Mouse Thrombospondin 1 (THBS1) |
|||||
|
THBS1 protein belongs to the thrombospondin family, a group of extracellular matrix proteins involved in various biological processes. THBS1 plays crucial roles in cell-matrix interactions, tissue remodeling, and angiogenesis. It is renowned for its ability to bind multiple receptors, including integrins and CD36, thereby regulating signaling pathways associated with cell adhesion, migration, and survival. THBS1 is also implicated in the modulation of inflammation and immune responses. It should be noted that the THBS1 protein lacks conserved residues required for the propagation of characteristic annotations, which may impact its function and interactions. Further research is necessary to fully understand the implications of this observation and its effect on the role of THBS1 in physiological and pathological processes. |
|||||
|
Product Information |
|||||
|
Source |
E. coli |
||||
|
Molecular Weight |
Approximately 36-40.6 kDa |
||||
|
AA Sequence |
NRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFRIENANLIPAVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLL AVERKDNTGQIFSVVSNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELDVPIQSIFTRDL ASVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSATNVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCD ELSSMVLELKGLRTIVTTLQDSIRKVTEENRELVSELKRPPLCFHNGVQYKNNEEWTVDSCTECHCQNSVTICK |
||||
|
Biological Activity |
When Mouse THBS1 is coated at 2 ¦Ìg/mL (100 ¦ÌL/well), it can bind Mouse Decorin. The ED50 for this effect is 0.3512 ¦Ìg/mL. |
||||
|
Formulation |
Lyophilized from a 0.2 µm filtered concentrated solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0. |
||||
|
Endotoxin |
<1.0 EU per ¦Ìg of protein, as determined by the LAL method. |
||||
|
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.5-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ¡Ü -20 ¡ãC. Further dilutions should be made in appropriate buffered solutions. |
||||
|
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
||||
|
Stability & Storage |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
||||
|
12 months from date of receipt, -20 to -70 ¡ãC as supplied. |
|||||
|
1 month, 2 to 8 ¡ãC under sterile conditions after reconstitution. |
|||||
|
3 months, -20 to -70 ¡ãC under sterile conditions after reconstitution. |
|||||
|
Usage Information |
|||||
|
This product is offered by InCellGen only for Scientific Research & Laboratory USE. NOT FOR OTHER USE. |
|||||
|
Order Information |
|
||||
|
Cata.No. |
Quantity |
Price($£© |
Price(€) |
Price(£¤/CNY£© |
|
|
CYT-Q80YQ1 |
10ug |
$260.00 |
€312.00 |
£¤2,600.00 |
|
|
CYT-Q80YQ1 |
50ug |
$550.00 |
€660.00 |
£¤5,500.00 |
|
|
CYT-Q80YQ1 |
100ug |
$850.00 |
€1,020.00 |
£¤8,500.00 |
|
|
Free Delivery on orders over $200.00. |
|||||
|
We Devoted Ourselves To The Development Of Biomedical Research Reagent. |
|||||
