Reagent
Guide
Guide_img
Reagent
Guide_img
Cytokine
Guide_img
Mouse Cytokine
Guide_img2
Recombinant Mouse GDNF,CYT-P48540
Click£º3053     Release date£º2020-5-14    Author£ºAdministrator    Source£ºOriginal

Recombinant Mouse GDNF,CYT-P48540

Background Information

Glial Cell Line-Derived Neurotrophic Factor (GDNF) is a 134-amino acid protein belonging to the GDNF family ligands (GFL). GDNF protein is widely distributed in the central and peripheral nervous systems. Its synthesis and secretion occur in various cell types, including glial cells such as astrocytes, oligodendrocytes, and Schwann cells; motor neurons (MNs); and skeletal muscle [1].Mature human GDNF shares 91-92% amino acid sequence identity with mouse, rat, and canine GDNF proteins, while mouse GDNF shares 99% identity with rat GDNF protein.

Initially isolated from cultured B49 rat glial cells, GDNF was found to enhance the survival and differentiation of dopaminergic neurons in primary cultures by promoting dopamine uptake. Similar to other members of the TGF-¦Â superfamily, GDNF is first synthesized as a precursor protein (pro-GDNF). Through a series of proteolytic cleavage and processing steps, the 211-amino acid pro-GDNF is ultimately converted into the active, mature form of GDNF. GDNF triggers phosphorylation of the receptor tyrosine kinase RET, and its downstream effects have been shown to promote neuronal health and survival. The binding of GDNF to its receptors activates multiple intracellular signaling pathways that play crucial roles in the development, survival, and maintenance of neuron-neuron and neuron-target tissue interactions. The synthesis and regulation of GDNF have been shown to be altered in various diseases, aging, exercise, and addiction. The neuroprotective effects of GDNF hold potential for developing therapeutic strategies to ameliorate neurodegenerative diseases such as amyotrophic lateral sclerosis (ALS) [1].GDNF is a potent neurotrophic factor regulating MN survival in the peripheral nervous system. It prevents MN apoptosis during development, reduces MN loss in animal models of motor neuropathy and degeneration, protects MNs from axotomy-induced cell death, and shields MNs from chronic degeneration. Intracerebral administration of GDNF exerts protective and reparative effects on the nigrostriatal dopamine system, which may have implications for developing novel therapeutic strategies for Parkinson''''s disease [1][2].

Description

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belonging to the GDNF family ligands (GFLs), promotes the survival of dopaminergic neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons [1]. GDNF Protein, Mouse (CHO) is produced in CHO cells and consists of 134 amino acids (S78-I211).

Full Name

Recombinant Mouse Glial Cell Line-Derived Neurotrophic Factor (GDNF) Protein (CHO-derived)

Specifications

Source: CHO cells.

Species: Mouse.

Amino Acid Sequence: MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTD

LGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Accession #: P48540 (S78-I211)

Gene ID: 14573 [NCBI]

Molecular Weight: Approximately 17-22 kDa, as determined by SDS-PAGE under reducing conditions, due to glycosylation.

Protein Length: Full length of mature GDNF.   Tag: Tag Free.

Protein Structure: N-term ¡ª GDNF (S78-I211) ¡ª C-term   Glycosylation: Yes.

Purity: >95% as determined by reducing SDS-PAGE.

Form: Sterile lyophilized powder.

Formulation: Lyophilized from a 0.22 µm filtered solution in PBS.

Endotoxin Level: <0.2 EU/µg, determined by the LAL method.

Biological Activity: The ED50 is <8 µg/mL as measured by C6 cell proliferation assay.

In Vitro Study: Recombinant rat GDNF (10 ng/mL) maintains proliferation and self-renewal of mouse spermatogonial stem cells [3].

In Vivo Study: In a mouse Parkinson''''s disease model, recombinant mouse GDNF (10 µg/2 µL) injected over the substantia nigra or in striatum before MPTP potently protects the dopamine system, as shown by numbers of mesencephalic dopamine nerve cell bodies, dopamine nerve terminal densities, and dopamine levels. When GDNF is administered after MPTP, dopamine levels and fiber densities are significantly restored [1].

Storage & Stability

Lyophilized Powder: Store at -20¡ãC for up to 2 years from the date of receipt.

Reconstituted Solution: After reconstitution, it is stable at 4¡ãC for 1 week or at -20¡ãC for longer periods when a carrier protein is added (see Reconstitution).

Long-term Storage: For extended storage, it is recommended to aliquot the reconstituted solution and freeze at -20¡ãC or -80¡ãC.

Shipping

Shipped at room temperature. Transit times may vary for destinations outside the continental US.

Aliases

rMuGDNF; GDNF; ATF; Astrocyte-derived trophic factor; Glial cell line-derived neurotrophic factor

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 µg/mL in sterile ddHO. For long-term storage of the reconstituted solution, it is recommended to add a carrier protein (e.g., 0.1% BSA, 5% HSA, 10% FBS, or 5% Trehalose).

References

[1] Alberto F Cintr¨®n-Col¨®n, et al. GDNF synthesis, signaling, and retrograde transport in motor neurons. Cell Tissue Res. 2020 Oct;382(1):47-56.

[2] Merighi A. Targeting the glial-derived neurotrophic factor and related molecules for controlling normal and pathologic pain. Expert Opin Ther Targets. 2016;20(2):193-208.

[3] Hannu Sariola, et al. GDNF maintains mouse spermatogonial stem cells in vivo and in vitro. Methods Mol Biol. 2008;450:127-35.

[4] Tomac A, et al. Protection and repair of the nigrostriatal dopaminergic system by GDNF in vivo. Nature. 1995;373(6512):335-339.

Order Information

Cat./REF.

Size

Price($£©

Price(€)

Price(£¤/CNY£©

Price(£¤/JYP£©

CYT-P48540

5ug

$185.00

€ 222.00

£¤1,850.00

£¤36,815.00

CYT-P48540

10ug

$325.00

€ 390.00

£¤3,250.00

£¤64,675.00

CYT-P48540

20ug

$565.00

€ 678.00

£¤5,650.00

£¤112,435.00

CYT-P48540

100ug

$1,650.00

€ 1,980.00

£¤16,500.00

£¤328,350.00

 

InCellGene


Copyright @ 2003-2026 InCellGene LLC.
twitter.com
facebook.com
linkedin.com
dribbble.com