|
Recombinant Human CILP1 |
||||||
|
|
|
Cat.No.: |
CYT-O75339 |
|
|
|
|
Background |
||||||
|
Recombinant Human CILP1 |
||||||
|
Probably plays a role in cartilage scaffolding. May act by antagonizing TGF-beta1 (TGFB1) and IGF1 functions. Has the ability to suppress IGF1-induced proliferation and sulfated proteoglycan synthesis, and inhibits ligand-induced IGF1R autophosphorylation. May inhibit TGFB1-mediated induction of cartilage matrix genes via its interaction with TGFB1. Overexpression may lead to impair chondrocyte growth and matrix repair and indirectly promote inorganic pyrophosphate (PPi) supersaturation in aging and osteoarthritis cartilage. |
||||||
|
Information |
||||||
|
Source |
Escherichia coli. |
|||||
|
Molecular Weight |
Approximately 57.6 KD. |
|||||
|
AA Sequence |
IPSRSFYRQNGEPYIGKVKASVTFLDPRNISTATAAQTDLNFINDEGDTFPLRTY |
|||||
|
Unit Definition Assay |
Separation of reaction products are visualized by SDS-PAGE. |
|||||
|
Physical Appearance |
Sterile Filtered Clear Solution.. |
|||||
|
Formulation |
20mM Tris, 150mM NaCl, pH8.0, containing 0.01% skl, 5%Trehalose. |
|||||
|
Endotoxin |
Less than 0.1 EU/mg as determined by LAL method. |
|||||
|
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ¡Ü -20¡æ. Further dilutions should be made in appropriate buffered solutions. |
|||||
|
Purity |
> 95 % by SDS-PAGE and HPLC analyses. |
|||||
|
Stability & Storage |
It is recommended to freeze aliquots at -80¡ãC for extended storage. Avoid repeated freeze-thaw cycles. |
|||||
|
Stored at -80¡æ for 1 year. |
||||||
|
2 weeks, 2 to 8¡æunder sterile conditions after reconstitution. |
||||||
|
It is stable at -20¡æ for 3 months after opening. |
||||||
|
Usage Information |
|
|
|
|
|
|
|
This product is offered by InCellGen only for Scientific Research & Laboratory USE. NOT FOR OTHER USE. |
||||||
|
Order Information |
|
|
|
|
|
|
|
Quantity |
Price($) |
Price(€) |
Price(£¤CN) |
Price(£¤JP) |
||
|
10ug |
$156.00 |
€171.60 |
£¤1,560.00 |
£¤34,320.00 |
||
|
50ug |
$650.00 |
€715.00 |
£¤6,500.00 |
£¤14,300.00 |
||
|
200ug |
$1,850.00 |
€2,035.00 |
£¤18,500.00 |
£¤40,700.00 |
||
|
Free Delivery on orders over $200.00. |
||||||
|
We Devoted Ourselves To The Development Of Biomedical Research Reagent. |
||||||
